PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400038596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 174aa    MW: 19498.2 Da    PI: 9.5985
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400038596genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB94.97.2e-301851094
                 NF-YB 10 ianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                          +anv+rim+ +lP+naki + +ke+vq+  s +i  +t++a ++c++e+rkt++++d+lwa+ ++G+ +++  l +yl++yre +
  PGSC0003DMP400038596  1 MANVTRIMRGILPTNAKINDGSKESVQKLGSYYINRITKKAKERCNKEQRKTVTAEDILWAMNKMGLTNHAGLLAQYLNRYREYN 85
                          79********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.84E-23186IPR009072Histone-fold
PfamPF008089.4E-17162IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.6E-28286IPR009072Histone-fold
PRINTSPR006151.1E-52644No hitNo description
PRINTSPR006151.1E-54563No hitNo description
PRINTSPR006151.1E-56482No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MANVTRIMRG ILPTNAKIND GSKESVQKLG SYYINRITKK AKERCNKEQR KTVTAEDILW  60
AMNKMGLTNH AGLLAQYLNR YREYNQVSYF NVRKPNCELT FASLAAPHPI LPIEPIPGYP  120
YPYFPPNVLF YDPVTAALVT SRDFEMAVGN DGSPSESSSS TVAPAYPFGQ WRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-221831092Transcription factor HapC (Eurofung)
4g92_B5e-221831092Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-132HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346131.11e-128PREDICTED: nuclear transcription factor Y subunit B-9-like
SwissprotQ84W663e-28NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLM1C0X71e-128M1C0X7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000573791e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14746510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.26e-30nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]